PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010904552.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family BES1
Protein Properties Length: 179aa    MW: 20289.4 Da    PI: 11.3765
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010904552.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF82284.62.7e-26673976
          DUF822  9 wkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76
                     kE+E+ k++ER+R  i+ +i++GLR++Gny+l+ r+D+neV + L+r  Gw+v +D tt++  s+  
  XP_010904552.1  6 PKEKEKMKLKERHRWVITMRILSGLRQHGNYNLRTRTDINEVTAPLARGVGWIVLPDDTTFPSRSSAS 73
                    59***********************************************************9655544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.7E-24674IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MRRLWPKEKE KMKLKERHRW VITMRILSGL RQHGNYNLRT RTDINEVTAP LARGVGWIVL  60
PDDTTFPSRS SASSSRLLPG FHLSPSSLVY PSHLPYLHHL RLPQKPRRPR SPARRRLYSS  120
TAVINARDLM DDLDDLSSST STSKKPYLCD WMPTGPIGLG PFSGSGLGSG LYISKKNRA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010904552.11e-127PREDICTED: protein BZR1 homolog 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1969568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.11e-24beta-amylase 7